You have no items in your shopping cart.
DPP4 Rabbit Polyclonal Antibody
SKU: orb585596
Description
Research Area
Epigenetics
Images & Validation
−Item 1 of 4
| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | DPP4 |
| Protein Sequence | Synthetic peptide located within the following region: DSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVH |
| Molecular Weight | 84kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CD26, ADABP, ADCP2, DPPIV, TP103
Similar Products
−- Item 1 of 4
CD26 rabbit pAb Antibody [orb771262]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 5
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
DPP4 antibody - C-terminal region (orb585596), Sample Type: Normal Human Prostate, Primary Antibody dilution: 1 ug/ml, Color/Signal Descriptions: DPP4 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: DPP4.
DPP4 antibody - C-terminal region (orb585596), Sample Type: Normal Human Prostate, Primary Antibody dilution: 1 ug/ml, Color/Signal Descriptions: DPP4 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: DPP4.
Lanes: Lane 1: 15 ug MDA-MB-231 lysate, Lane 2: 15 ug MCF-7 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Donkey anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: DPP4.
WB Suggested Anti-DPP4 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC
Immunohistochemistry
DPP4 Rabbit Polyclonal Antibody (orb585596)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 3-7 working days