You have no items in your shopping cart.
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 1-250aa |
| Protein Length | Full Length |
| Endotoxins | Not test |
| MW | 28.9 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−35 kDa lectin;Carbohydrate-binding protein 35;Galactose-specific lectin 3;Galactoside-binding protein;IgE-binding protein;L-31;Laminin-binding protein;Lectin L-29;Mac-2 antigen
Similar Products
−- Item 1 of 6
Gal3/Galectin-3 Mouse Recombinant Antibody [orb2957321]
ELISA, FC
Human
Mouse
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μg - Item 1 of 4
Recombinant Human LGALS3 Protein [orb2994886]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 27.2 KDa. Observed: 35 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human LGALS3 Protein [orb2995240]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 26 KDa. Observed: 30 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 1
Human Galectin-3 Recombinant Protein [orb1905936]
> 98 % by SDS-PAGE and HPLC analyses.
Approximately 26.0 kDa, a single non-glycosylated polypeptide chain containing 249 amino acids.
10 μg, 100 μg, 500 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days