Ambp Rabbit Polyclonal Antibody

SKU: orb584239

Description

Ambp Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Ambp. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ambp. This antibody reacts with Rat samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Rat
Predicted Reactivity	Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Sheep

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ambp
Target	Ambp
Protein Sequence	Synthetic peptide located within the following region: ELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGDGYEELTRS
Molecular Weight	38kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

UTI

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Ambp

UniProt

Q64240

RefSeq (Protein):NP_037033

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_037033

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Applications:	IHC-P, WB
Reactivity:	Mouse, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, IF, IHC-Fr, IHC-P
Predicted Reactivity:	Mouse
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	WB
Predicted Reactivity:	Bovine, Equine, Guinea pig, Porcine, Rabbit, Rat
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	IHC-P, WB
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, IHC, WB
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated