Egr1 Rabbit Polyclonal Antibody

SKU: orb576117

Description

Rabbit polyclonal antibody to Egr1

Research Area

Cell Biology, Epigenetics & Chromatin, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 3

Tested Applications	IHC, WB
Reactivity	Frog, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Sheep

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Target	Egr1
Protein Sequence	Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV
Molecular Weight	56kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

NG, TI, NGF, Zen, egr, Egr-, Krox, NGF1, TIS8, Zenk, Zfp-, ETR10, Egr-1, Krox-, NGFIA, Zfp-6, Zif26, ETR103, Krox-1, Krox24, NGF1-A, NGFI-A, Zif268, Krox-24, A530045N19Rik

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Frog brain, Primary Antibody Dilution: 1:500, Secondary Antibody: Biotinylated goat anti-rabbit, Secondary Antibody Dilution: 1:200, Color/Signal Descriptions: Black: EGR1, Gene Name: Egr1 a.

WB Suggested Anti-Egr1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Heart.

Quick Database Links

Gene Symbol

Egr1

UniProt

P08046

RefSeq (Protein):NP_031939

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_031939

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols