You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | FCGR2B |
| Protein Sequence | Synthetic peptide located within the following region: CREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI |
| Molecular Weight | 34kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CD32 Rabbit Polyclonal Antibody [orb13406]
FC, WB
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlCD32 (phospho Tyr292) rabbit pAb Antibody [orb768102]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μlCD32-B/C rabbit pAb Antibody [orb766851]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rabbit Anti-FCGR2B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Placenta, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-FCGR2B antibody, Formalin Fixed Paraffin Embedded Tissue: Human Thyroid, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-FCGR2B Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_001002275 |
|---|
Documents Download
Request a Document
Protocol Information
FCGR2B Rabbit Polyclonal Antibody (orb585683)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






