FZD7 Rabbit Polyclonal Antibody

SKU: orb330165

Description

Rabbit polyclonal antibody to FZD7

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 5

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human FZD7
Target	FZD7
Protein Sequence	Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
Molecular Weight	63kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti FzE3 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/mL.

Positive control (+): HepG2 (HG), Negative control (-): Human liver (LI), Antibody concentration: 0.2 ug/mL.

Rabbit Anti-FZD7 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-FZD7 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

FZD7

UniProt

O75084

RefSeq (Protein):NP_003498

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_003498

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols