GPX4 Rabbit Polyclonal Antibody

SKU: orb330978

Description

Rabbit polyclonal antibody to GPX4

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 4

Tested Applications	IHC, WB
Reactivity	Human, Rat
Predicted Reactivity	Bovine, Goat, Guinea pig, Mouse, Yeast, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human GPX4
Target	GPX4
Protein Sequence	Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA
Molecular Weight	19 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti MCSP antibody, anti PHGPx antibody, anti snGPx antibody, anti snPHGPx antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Recognizes 19 kDa cytoplasmic form in these cell lines, mitochondrial form of 22 kDa appears absent in these samples.

GPX4 antibody - middle region (orb330978) validated by WB using HepG2 cell lysate at 1.0 ug/ml. GPX4 is supported by BioGPS gene expression data to be expressed in HepG2.

Immunohistochemistry with formalin-fixed, paraffin-embedded human Heart tissue at an antibody concentration of 5.0 ug/ml using anti-GPX4 antibody (orb330978).

Immunohistochemistry with Rat Brain lysate tissue.

Quick Database Links

Gene Symbol

GPX4

UniProt

P36969

RefSeq (Protein):NP_002076

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_002076

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols