HBEGF Rabbit Polyclonal Antibody

SKU: orb579406

Description

Rabbit polyclonal antibody to HBEGF

Research Area

Cardiovascular Research, Cell Biology

Images & Validation

−

Item 1 of 2

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Human HBEGF
Target	HBEGF
Protein Sequence	Synthetic peptide located within the following region: FLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKV
Molecular Weight	22kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

DTR, DTS, DTSF, HEGFL

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: PANC1 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that HBEGF is expressed in PANC1.

Rabbit Anti-HBEGF antibody, Formalin Fixed Paraffin Embedded Tissue: Human Uterus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Quick Database Links

Gene Symbol

HBEGF

UniProt

Q99075

RefSeq (Protein):NP_001936

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001936

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols