MEDAG Rabbit Polyclonal Antibody

SKU: orb326838

Featured

Description

MEDAG Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MEDAG. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human MEDAG. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of Human MEDAG
Target	MEDAG
Protein Sequence	Synthetic peptide located within the following region: MLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESY
Molecular Weight	33kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti AWMS3 antibody, anti hAWMS3 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

MEDAG

UniProt

Q5VYS4

RefSeq (Protein):NP_116238

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_116238

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Filter by Applications

IHC (1)
WB (1)

Filter by Species

Mouse (1)

Haixia Liu 1, Zhiyue Chang 2, Shuling Liu 3, Ruyuan Zhu 1, Jiayi Ma 1, Xinyue Lu 1, Lei Li 3, Zhiguo Zhang MEDAG expression in vitro and paeoniflorin alleviates bone loss by regulating the MEDAG/AMPK/PPARγ signaling pathway in vivo Heliyon, 10, e24241 (2024)

PubMed: 38226230

Applications

IHC, WB

Reactivity

Mouse

Applications:	ELISA, WB
Predicted Reactivity:	Mouse, Rat
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	IHC, WB
Reactivity:	Human, Mouse
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	WB
Predicted Reactivity:	Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	HRP

Applications:	WB
Predicted Reactivity:	Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	FITC