Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

MPG Rabbit Polyclonal Antibody

SKU: orb579254

Description

Rabbit polyclonal antibody to MPG

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MPG
TargetMPG
Protein SequenceSynthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
Molecular Weight32kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AAG, MDG, ADPG, APNG, Mid1, anpg, PIG11, PIG16, CRA36.1

Similar Products

  • MPG Rabbit Polyclonal Antibody [orb628899]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • MPG Rabbit Polyclonal Antibody [orb633109]

    ELISA,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • MPEG1 Rabbit Polyclonal Antibody [orb2954817]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • MPG Rabbit Polyclonal Antibody [orb2955296]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • MPEG1/Macrophage Specific Gene Rabbit Polyclonal Antibody (FITC) [orb188591]

    ICC,  IF

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

MPG Rabbit Polyclonal Antibody

MPG was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579254 with 1:200 dilution. Western blot was performed using orb579254 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: MPG IP with orb579254 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

MPG Rabbit Polyclonal Antibody

WB Suggested Anti-MPG Antibody, Positive Control: Lane 1: 50 ug RCC4 lysate, Lane 2: 50 ug RCC4 lysate, Lane 3: 50 ug 786-0 lysate, Lane 4: 50 ug 786-0 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa 680, Secondry Antibody Dilution: 1:5000.

MPG Rabbit Polyclonal Antibody

WB Suggested Anti-MPG Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

MPG Rabbit Polyclonal Antibody (orb579254)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry