POLQ Rabbit Polyclonal Antibody

SKU: orb580669

This product can be custom made

Description

Rabbit polyclonal antibody to DNA Polymerase theta

Research Area

Epigenetics & Chromatin

Images & Validation

−

Item 1 of 6

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ
Target	POLQ
Protein Sequence	Synthetic peptide located within the following region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL
Molecular Weight	290 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

PRO0327

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. Several high molecular weight isoforms contain this peptide sequence including 290 kDa, 198 kDa, and 129.

Sample Tissue: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Thyroid, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Placenta (PL), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

POLQ (polymerase (DNA directed), theta) Antibody (against the C terminal of POLQ) (50 ug) validated by WB using Placenta Lysate at 0.2-1 ug/ml.

Quick Database Links

Gene Symbol

POLQ

UniProt

O75417

RefSeq (Protein):NP_955452.3

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_955452.3

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols