PSIP1 Rabbit Polyclonal Antibody

SKU: orb575181

Description

Rabbit polyclonal antibody to PSIP1

Research Area

Epigenetics & Chromatin

Images & Validation

−

Item 1 of 4

Tested Applications	WB
Reactivity	Human, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human PSIP1
Target	PSIP1
Protein Sequence	Synthetic peptide located within the following region: AADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
Molecular Weight	60 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

p52, p75, PAIP, DFS70, LEDGF, PSIP2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by phosphorylation, citrullination, and/or sumoylation.

Human Jurkat

WB Suggested Anti-PSIP1 Antibody, Positive Control: Lane 1: 5 ug mouse brain cytoplasm, Lane 2: 5 ug mouse brain nucleus, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit-IR-dye, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-PSIP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, PSIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

PSIP1

UniProt

O75475

RefSeq (Protein):NP_150091

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_150091

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols