Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RAB5B Rabbit Polyclonal Antibody

SKU: orb583190

Description

RAB5B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RAB5B. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human RAB5B. This antibody reacts with Human, Mouse, Zebrafish samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse, Zebrafish
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RAB5B
TargetRAB5B
Protein SequenceSynthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE
Molecular Weight24kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • RAB5A/B/C Rabbit Polyclonal Antibody [orb1145802]

    ELISA,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • RAB5B Antibody (Center) [orb1933029]

    WB

    Gallus

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • RAB5B rabbit pAb Antibody [orb773006]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • RAB5B Rabbit Polyclonal Antibody [orb667872]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • RAB5B Rabbit Polyclonal Antibody [orb630448]

    ELISA,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RAB5B Rabbit Polyclonal Antibody

Sample type: zebrafish gut epithelial cells, Green: primary, Red: actin, Blue: DAPI, Primary dilution: 1:5000, Secondary dilution: 1:300.

RAB5B Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

RAB5B Rabbit Polyclonal Antibody

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

RAB5B Rabbit Polyclonal Antibody

WB Suggested Anti-RAB5B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002859

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

RAB5B Rabbit Polyclonal Antibody (orb583190)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry