Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RPL15 Rabbit Polyclonal Antibody

SKU: orb586169

Description

RPL15 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting RPL15. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetRPL15
Protein SequenceSynthetic peptide located within the following region: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK
Molecular Weight24 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

L15, EC45, DBA12, RPL10, RPLY10, RPYL10

Similar Products

  • RPL15 Antibody (N-term) [orb1937202]

    FC,  IHC-P,  WB

    Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • RPL15 Rabbit Polyclonal Antibody [orb1880613]

    FC,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl, 30 μl
  • RPL15 Rabbit Polyclonal Antibody [orb630788]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • RPL15 Antibody [orb683861]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Ribosomal Protein L15 Polyclonal Antibody [orb1412286]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RPL15 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

RPL15 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 3 ug/ml.

RPL15 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

RPL15 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 3 ug/ml.

RPL15 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 3 ug/ml.

RPL15 Rabbit Polyclonal Antibody

WB Suggested Anti-RPL15 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002939

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

RPL15 Rabbit Polyclonal Antibody (orb586169)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry