You have no items in your shopping cart.
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Porcine |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | SLAMF1 |
| Protein Sequence | Synthetic peptide located within the following region: GKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEP |
| Molecular Weight | 37kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti CD 150 antibody, anti Cd150 antibody, anti CD150 antigen antibody, anti Cdw150 antibody, anti Estm51 antibody, anti Ipo 3 antibody, anti IPO-3 antibody, anti Ipo3 antibody, anti Signaling lymphocytic activation molecule antibody, anti Signaling lymphocytic activation molecule family member 1 antibody, anti Signaling lymphocytic activation molecule family member 1, isoform CRA_a antibody, anti Signaling lymphocytic activation molecule family member 1, isoform CRA_b antibody, anti Signaling lymphocytic activation molecule precursor antibody, anti Slaf1 antibody, anti SLAM family, member 1 antibody, anti Slamf 1 antibody, anti Slamf1 antibody, anti SLAMF1 protein antibody
Similar Products
−- Item 1 of 2
CD150/SLAM Rabbit Polyclonal Antibody [orb101809]
ELISA, IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Human, Porcine, Sheep
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 2
SLAM rabbit pAb Antibody [orb766884]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 2
- Item 1 of 4
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Available Sizes
Select a size below
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 1 - 2 weeks