UNQ1887 Rabbit Polyclonal Antibody

SKU: orb325768

Description

UNQ1887 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SPPL3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human UNQ1887. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human UNQ1887
Target	SPPL3
Protein Sequence	Synthetic peptide located within the following region: VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF
Molecular Weight	42kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti DKFZp586C1324 antibody, anti IMP2 antibody, anti MDHV1887 antibody, anti MGC126674 antibody, anti MGC126676 antibody, anti MGC90402 antibody, anti PRO4332 antibody, anti PSL4 antibody, anti SPPL3 antibody, anti UNQ1887 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

SPPL3

UniProt

Q3MJ04

RefSeq (Protein):NP_620584

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_620584

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Applications:	WB
Predicted Reactivity:	Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	HRP

Applications:	WB
Predicted Reactivity:	Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	FITC

Applications:	WB
Predicted Reactivity:	Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Biotin