SRP54A Rabbit Polyclonal Antibody

SKU: orb324861

Description

SRP54A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting SRP54A. It is suitable for WB and is reactive with rat samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Sheep, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Rat
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Sheep, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Target	SRP54A
Protein Sequence	Synthetic peptide located within the following region: DGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGL
Molecular Weight	55kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti Srp54 antibody, anti Srp54a antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

SRP54A

UniProt

Q6AYB5

RefSeq (Protein):NP_446323

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_446323

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Applications:	WB
Predicted Reactivity:	Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	HRP

Applications:	WB
Predicted Reactivity:	Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	FITC

Applications:	WB
Predicted Reactivity:	Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Biotin