TYRP1 Rabbit Polyclonal Antibody

SKU: orb325137

Description

TYRP1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TYRP1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human TYRP1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

−

Item 1 of 8

Tested Applications	IHC, WB
Reactivity	Human, Mouse
Predicted Reactivity	Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human TYRP1
Target	TYRP1
Protein Sequence	Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
Molecular Weight	61 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti CAS2 antibody, anti CATB antibody, anti GP75 antibody, anti TRP antibody, anti TYRP antibody, anti b-PROTEIN antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

TYRP1

UniProt

P17643

RefSeq (Protein):NP_000541

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_000541

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry