Cart summary

You have no items in your shopping cart.

Bovine CCL8 protein

SKU: orb1215662

Description

The Bovine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSTPITCCFSVINGKIPFKKLDSYTRITNSQCPQEAVIFKTKADRDVCADPKQKWVQTSIRLLDQKSRTPKP (76)) (Gene ID: 281044).

Images & Validation

Key Properties

SourceYeast
Biological OriginBovine
TargetCCL8
Molecular Weight8.6 kDa
Protein Length76.0
Protein SequenceQPDSVSTPITCCFSVINGKIPFKKLDSYTRITNSQCPQEAVIFKTKADRDVCADPKQKWVQTSIRLLDQKSRTPKP (76)
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Bovine MCP2 ELISA Kit [orb440711]

    Bovine

    15.625-1000 pg/mL

    6.4 pg/mL

    48 T, 96 T
  • Bovine MCP2 ELISA Kit (Ready to Use) [orb549264]

    Bovine

    15.6-1000 pg/mL

    6.4 pg/mL

    48 T, 96 T
  • Bovine CCL8 ELISA Kit [orb1498733]

    Bovine

    1 set (2 x capture antibody), 1 set (1 x capture antibody)
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Bovine CCL8 protein (orb1215662)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
¥ 3,900.00
25 μg
¥ 7,020.00
100 μg
¥ 17,420.00
500 μg
¥ 55,380.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry