[DPro5] Corticotropin Releasing Factor, human, rat

SKU: orb2694799

Description

[DPro5] Corticotropin Releasing Factor, human, rat is a selective R2 agonist of corticotropin releasing factor/hormone. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin. [DPro5] Corticotropin Releasing Factor, human, rat fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat.

Images & Validation

−

Key Properties

−

Target	CRFR
Molecular Weight	4757.45
Protein Sequence	SEEP-{D-Pro}-ISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Purity	≥95%

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

CRFR

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols