You have no items in your shopping cart.
Human MOG Protein
SKU: orb81220
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2µm filtered solution in 20mM HAc-NaAc and 150mM NaCl pH-4.5 |
| Disclaimer | For research use only |
Alternative Names
−Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.
Similar Products
−Human Anti-Myelin Oligodendrocyte Glycoprotein Antibody (Anti-MOG) ELISA Kit [orb781920]
Human
3.13-200 ng/mL
1.15 ng/mL
48 T, 96 THuman MOG protein [orb604902]
Greater than 85% as determined by SDS-PAGE.
17.9 kDa
E.coli
1 mg, 20 μg, 100 μgMyelin oligodendrocyte glycoprotein (MOG) (NM_206809) Human Recombinant Protein [orb3044607]
> 80% as determined by SDS-PAGE and Coomassie blue staining
25.1 kDa
20 μg, 100 μg, 1 mgRecombinant Human MOG Protein, N-His [orb2967796]
>90% as determined by SDS-PAGE.
16.06 kDa
1 mg, 100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human MOG Protein (orb81220)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


