You have no items in your shopping cart.
LEFTY2 Rabbit Polyclonal Antibody
SKU: orb330222
Description
Research Area
Cancer Biology, Cardiovascular Research, Disease Biomarkers, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Canine, Porcine, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human LEFTY2 |
| Target | LEFTY2 |
| Protein Sequence | Synthetic peptide located within the following region: AGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLL |
| Molecular Weight | 40kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti EBAF antibody, anti LEFTA antibody, anti LEFTYA antibody, anti TGFB4 antibody
Similar Products
−LEFTY2 Rabbit Polyclonal Antibody [orb330221]
IHC, WB
Bovine, Equine, Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlLEFTY2 Rabbit Polyclonal Antibody [orb628413]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Thymus Tumor lysates, Antibody Dilution: 1.0 ug/mL.
Documents Download
Datasheet
Product Information
Request a Document
LEFTY2 Rabbit Polyclonal Antibody (orb330222)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








