You have no items in your shopping cart.
NAA80 Rabbit Polyclonal Antibody
SKU: orb325411
Description
Research Area
Cancer
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Yeast |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NAT6 |
| Target | NAA80 |
| Protein Sequence | Synthetic peptide located within the following region: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGP |
| Molecular Weight | 34kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti FUS-2 antibody, anti FUS2 antibody
Similar Products
−NAT6/FUS2/NAA80 Rabbit Polyclonal Antibody (Fluoro647) [orb3093910]
FC
Human, Mouse
Rabbit
Polyclonal
Fluoro647
100 μgNAT6/FUS2/NAA80 Rabbit Polyclonal Antibody (Fluoro594) [orb3093911]
FC
Human, Mouse
Rabbit
Polyclonal
Fluoro594
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-NAT6 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.
Documents Download
Datasheet
Product Information
Request a Document
NAA80 Rabbit Polyclonal Antibody (orb325411)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review