Parathyroid Hormone(1-34), bovine

SKU: orb2693423

Description

Parathyroid Hormone (1-34), bovine is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis.

Images & Validation

−

Key Properties

−

Target	Thyroid Hormone Receptor
Molecular Weight	4108.7
Protein Sequence	AVSEIQFMHNGKHLSSMERVEWLRKKLQDVHNF
Purity	≥95%

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Thyroid Hormone Receptor

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols