Cart summary

You have no items in your shopping cart.

Porcine TNF alpha protein

SKU: orb1216340

Description

The Swine TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Swine TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086).

Images & Validation

Key Properties

SourceYeast
Biological OriginSwine
TargetTNF alpha
Molecular Weight16.9 kDa
Protein Length154.0
Protein SequenceSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

TNFSF2

Similar Products

  • Porcine TNF alpha protein [orb1215718]

    98%

    16.9 kDa

    Yeast

    10 μg
  • Porcine TNFA protein [orb633345]

    ELISA,  WB

    Greater than 95% by SDS-PAGE gel analyses

    17.2 KDa

    E.Coli

    50 μg, 100 μg, 200 μg, 1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Porcine TNF alpha protein (orb1216340)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
¥ 3,900.00
25 μg
¥ 7,020.00
100 μg
¥ 17,420.00
500 μg
¥ 55,380.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry