Cart summary

You have no items in your shopping cart.

PRKAA1 Rabbit Polyclonal Antibody

SKU: orb582168

Description

Rabbit polyclonal antibody to PRKAA1

Research Area

Epigenetics & Chromatin, Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PRKAA1
TargetPRKAA1
Protein SequenceSynthetic peptide located within the following region: SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
Molecular Weight63kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AMPK, AMPKa1, AMPK alpha 1

Similar Products

  • Phospho-AMPK alpha-1 (Thr183) Rabbit Polyclonal Antibody [orb4412]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-AMPK alpha-2 (Thr172) Rabbit Polyclonal Antibody [orb99303]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-AMPK alpha 1 (Ser356) Rabbit Polyclonal Antibody [orb506148]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • AMPK alpha 1 Rabbit Polyclonal Antibody [orb10076]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-AMPK alpha 1 (Thr183) + AMPK alpha 2 (Thr172) Rabbit Polyclonal Antibody [orb182418]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PRKAA1 Rabbit Polyclonal Antibody

Sample Type: rat hepatocyte (50 ug), Priamry dilution: 1:4000, Secondary Antibody: Donkey anti-Rabbit HRP, Secondary dilution: 1:10000.

PRKAA1 Rabbit Polyclonal Antibody

PRKAA1 antibody - middle region (orb582168) validated by WB using Rat liver and Mouse muscle at 1:1000.

PRKAA1 Rabbit Polyclonal Antibody

WB Suggested Anti-PRKAA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006242

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PRKAA1 Rabbit Polyclonal Antibody (orb582168)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry