Cart summary

You have no items in your shopping cart.

PTK2 Rabbit Polyclonal Antibody

SKU: orb587536

Description

Rabbit polyclonal antibody to PTK2

Research Area

Cell Biology, Neuroscience, Protein Biochemistry, Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human PTK2
TargetPTK2
Protein SequenceSynthetic peptide located within the following region: IELGRC' target='_blank'>SEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRC
Molecular Weight47kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

FAK, FADK, FAK1, FRNK, FADK 1, PPP1R71, p125FAK, pp125FAK

Similar Products

  • Phospho-FAK (Tyr925) Rabbit Polyclonal Antibody [orb5215]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-FAK (Tyr397) Rabbit Polyclonal Antibody [orb106222]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • FAK Polyclonal Antibody [orb1413766]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • FAK (phospho Tyr861) rabbit pAb Antibody [orb764187]

    ELISA,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • FAK (phospho Tyr397) rabbit pAb Antibody [orb764367]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PTK2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

PTK2 Rabbit Polyclonal Antibody

Sample Type: HepG2 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

PTK2 Rabbit Polyclonal Antibody

Rabbit Anti-PTK2 Antibody, Catalog Number: orb587536, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Plasma membrane, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PTK2 Rabbit Polyclonal Antibody (orb587536)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry