You have no items in your shopping cart.
Recombinant Bovine Myelin-oligodendrocyte glycoprotein(MOG)
SKU: orb2928970
Description
Images & Validation
−
Key Properties
−| Biological Origin | Bos taurus (Bovine) |
|---|---|
| Expression Region | 29-246 |
| Protein Length | Full length protein |
| Protein Sequence | GQFRVIGPGHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDEE QAPEYRGRTQLLKETIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFY WINPGVLVLIAVLPVLLLQITVGLVFLCLQRRLRGKLWAEIENLHRTFDPHFLMVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF |
Storage & Handling
−| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Disclaimer | For research use only |
Alternative Names
−Myelin-oligodendrocyte glycoprotein

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Bovine Myelin-oligodendrocyte glycoprotein(MOG) (orb2928970)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review