Recombinant Mouse IFN gamma

SKU: orb623199

Description

IFN-gamma, or type II interferon, is a cytokine that is critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Mouse IFN gamma Recombinant Protein is purified IFN gamma produced in yeast.

Images & Validation

−

Application Notes	The Rat APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.

Key Properties

−

Source	Yeast
Molecular Weight	15.5 kDa
Protein Sequence	HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLK DNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLL PESSLRKRKRSRC (133)

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Similar Products

−

Mouse IFN gamma [orb3002359]

Purity:	SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)
MW:	Predicted: 15.5 KDa. Observed: 12-20 KDa, reducing conditions

Sizes Available: 10 μg, 50 μg, 500 μg, 1 mg

Mouse IL-18 [orb3002400]
Purity:
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
MW:
Predicted: 19.7 KDa. Observed: 20 KDa, reducing conditions
Sizes Available: 10 μg, 50 μg, 500 μg, 1 mg
Mouse IFN gamma [orb3002377]
Purity:
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
MW:
Predicted: 16.6 KDa. Observed: 15-28 KDa, reducing conditions
Sizes Available: 10 μg, 50 μg, 500 μg, 1 mg
Mouse IFN gamma [orb3002457]
Purity:
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
MW:
Predicted: 15.7 KDa. Observed: 14 KDa, reducing conditions
Sizes Available: 10 μg, 50 μg, 500 μg, 1 mg
Mouse IFNGR1 [orb3002227]
Purity:
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
MW:
Predicted: 26.9 KDa. Observed: 38-55 KDa, reducing conditions
Sizes Available: 10 μg, 50 μg, 1 mg, 500 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols