Cart summary

You have no items in your shopping cart.

RecombinantGH,Human(CHO-expressed)

SKU: orb1494738

Description

Growth hormone (GH), also known as somatotropin, is a member of a family of growth factors that includes prolactin, placental lactogens, proliferins, and somatolactin. It is synthesized primarily by somatotropes in the anterior pituitary and is stored in secretary granules. The pulsatile release of GH into circulation is regulated by the concerted actions of the hypothalamic hormones-GH-releasing hormone (GHRH) and somatostatin (SST) - as well as by signals from the periphery - ghrelin and leptin. The human GH cDNA encodes a 217 amino acid (aa) residue precursor protein with a 26 aa putative signal peptide. By alternative splicing, at least four isoforms of GH have been identified.

Images & Validation

Application Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

SourceCHO
Biological ActivityED50 2 x 10ˆ6 units/mg
Molecular Weight20-24 kDa, observed by non-reducing SDS-PAGE.
Protein SequenceFPTIPLSRLFDNASLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISL LLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNY GLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Purification> 95% as analyzed by SDS-PAGE and HPLC.
Purity> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins< 0.2 EU/μg, determined by LAL method.

Storage & Handling

StorageLyophilized recombinant Human Growth Hormone (GH) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhGH should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
DisclaimerFor research use only

Alternative Names

GH1, GH, GHN, GH-N, hGH-N,Pituitary growth hormone, Growth hormone 1, Somatotropin
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

RecombinantGH,Human(CHO-expressed) (orb1494738)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
¥ 3,770.00
50 μg
¥ 9,880.00