Cart summary

You have no items in your shopping cart.

REEP1 Rabbit Polyclonal Antibody (HRP)

SKU: orb2112641

Description

REEP1 Rabbit Polyclonal Antibody (HRP)

Images & Validation

Tested ApplicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human REEP1
Protein SequenceSynthetic peptide located within the following region: ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA
Molecular Weight22kDa
PurificationAffinity Purified
ConjugationHRP

Storage & Handling

StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HMN5B, SPG31, Yip2a, C2orf23

Similar Products

  • REEP1 Rabbit Polyclonal Antibody (HRP) [orb2112644]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • REEP1 Rabbit Polyclonal Antibody (HRP) [orb470152]

    WB

    Bovine, Canine, Equine, Gallus, Human, Porcine, Rabbit, Rat, Sheep

    Mouse

    Rabbit

    Polyclonal

    HRP

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_075063

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

REEP1 Rabbit Polyclonal Antibody (HRP) (orb2112641)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet