You have no items in your shopping cart.
SARS-CoV-2 (COVID-19) NTD Recombinant Protein
Description
Research Area
Images & Validation
−| Tested Applications | ELISA |
|---|---|
| Application Notes |
Key Properties
−| Source | HEK293 cells |
|---|---|
| Molecular Weight | The predicted molecular mass is ~36 kDa. |
| Protein Sequence | VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGT KRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCND PFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNID GYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAG AAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKS |
| Purity | >95% by SDS Page |
Storage & Handling
−| Storage | This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added._x000D_ _x000D_ |
| Concentration | 0.5 mg/ml |
| Expiration Date | 6 months from date of receipt. |
| Dry Ice Shipping | Please note: This product requires shipment on dry ice. A dry ice surcharge will apply. |
| Disclaimer | For research use only |
Similar Products
−SARS-CoV-2 (COVID-19) S1 Recombinant Protein NTD [orb1231454]
ELISA, WB
>90% as determined by SDS-PAGE.
34.9 kDa
HEK293 cells
0.1 mgSARS-CoV-2 (2019-nCoV) S1 protein NTD, His Tag [orb689470]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 33.7 kDa after removal of the signal peptide. The apparent molecular mass of S1-NTD-His is approximately 55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μgSARS-CoV-2 (2019-nCoV) S1 protein NTD, mFc Tag [orb689471]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 59.1 kDa after removal of the signal peptide.The apparent molecular mass of S1-NTD-mFc is approximately 70-100 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μgSARS-CoV-2 (2019-nCoV) S1 protein NTD, hFc Tag [orb689472]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 59.0 kDa after removal of the signal peptide. The apparent molecular mass of S1-NTD-hFc is approximately 70-100 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μgRecombinant Human COVID-19/SARS-CoV-2 NTD Protein Monoclonal Antibody [orb1141370]
ELISA
Recombinant
Unconjugated
500 μg, 100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Purified SARS-CoV-2 N-Terminal Domain (NTD) Spike Protein under non-reducing conditions. Lane 1-NTD Protein loaded at 10 μg.
Quick Database Links
NCBI Reference Sequences
−| RefSeq | QHD43416.1 |
|---|
Documents Download
Request a Document
SARS-CoV-2 (COVID-19) NTD Recombinant Protein (orb1231619)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




