You have no items in your shopping cart.
SARS-CoV-2 (COVID-19) RBD Recombinant Protein
Description
Research Area
Images & Validation
−| Tested Applications | ELISA |
|---|---|
| Application Notes |
Key Properties
−| Source | HEK293 cells |
|---|---|
| Molecular Weight | The predicted molecular mass is ~33 kDa. |
| Protein Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESN KKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCS |
| Purity | >95% by SDS Page |
Storage & Handling
−| Storage | This recombinant protein may be stored as received at 2-8°C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80°C. Avoid Repeated Freeze Thaw Cycles. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 6 months from date of receipt. |
| Dry Ice Shipping | Please note: This product requires shipment on dry ice. A dry ice surcharge will apply. |
| Disclaimer | For research use only |
Similar Products
−SARS-CoV-2 (COVID-19) Delta Variant Spike S1 (His-Avi Tag) Recombinant Protein [orb1228206]
ELISA, SDS-PAGE, WB
> 90% as determined by Bis-Tris PAGE
120 kD
HEK293 cells
0.05 mgSARS-CoV-2 (COVID-19) Delta Variant Spike RBD (His-Avi Tag) Recombinant Protein [orb1228207]
ELISA, SDS-PAGE, WB
> 95% as determined by Bis-Tris PAGE
35 kD
HEK293 cells
0.05 mgRecombinant SARS-Cov-2 Spike RBD protein (E417N, E484K, N501Y), His [orb1516703]
>90% as determined by SDS-PAGE
36 kDa
100 μg, 500 μg, 20 μgRecombinant SARS-Cov-2 Spike RBD protein, mFc (HEK293) [orb1516638]
>90% as determined by SDS-PAGE
60 kDa
100 μg, 500 μg, 20 μgCOVID-19 S Protein RBD (Omicron, B.1.1.529) [orb1473273]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
50 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Purified SARS-CoV-2 Receptor Binding Domain (RBD) Spike Protein under non-reducing conditions. Lane 1-RBD Protein loaded at 10 μg. Lane 2-RBD Protein loaded 20 μg
Quick Database Links
NCBI Reference Sequences
−| RefSeq | QHD43416.1 |
|---|
Documents Download
Request a Document
SARS-CoV-2 (COVID-19) RBD Recombinant Protein (orb1231620)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





















