You have no items in your shopping cart.
HTT Antibody
SKU: orb153341
Description
Images & Validation
−Item 1 of 1
| Tested Applications | IF, IHC-Fr, IHC-P, WB |
|---|---|
| Dilution range | WB:1:500-1:2,000, IF:1:500-1:2,000, IHC-P:1:500-1:2,000, IHC-F:1:500-1:2,000 |
| Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 85 to 200 aa of human HTT produced in E. coli. Antigen Sequence: PLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAEL |
| Target | Huntingtin |
| Purification | Epitope affinity purified |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Disclaimer | For research use only |
Alternative Names
−HD, HTT and IT15 antibody.
Similar Products
−- Item 1 of 7
- Item 1 of 3
Serotonin transporter Rabbit Polyclonal Antibody [orb13226]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Gallus, Guinea pig, Human, Porcine, Sheep
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Immunohistochemical analysis of Rat LV using Huntingtin antibody.
Quick Database Links
Gene Symbol
Huntingtin
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC-P
Immunohistochemistry Paraffin
IHC-Fr
Immunohistochemistry Frozen
IF
Immunofluorescence
HTT Antibody (orb153341)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 2-3 weeks