Human TNFR1 protein

SKU: orb245321

Featured

Description

This Human TNFR1 protein spans the amino acid sequence from region 31-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Cell Biology

Images & Validation

−

Item 1 of 1

Application Notes	This is GST-tag protein

Key Properties

−

Source	E.coli
Biological Origin	Homo sapiens (Human)
Tag	N-terminal GST-tagged
Molecular Weight	47.2 kDa
Expression Region	31-210aa
Protein Length	Partial
Protein Sequence	VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT
Purity	Greater than 90% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Disclaimer	For research use only

Alternative Names

−

CD120a Protein, FPF Protein, MGC19588 Protein, p55 Protein, p55-R Protein, p60 Protein, TBP1 Protein, TBPI Protein, TNF R Protein, TNF R55 Protein, TNF-R1 Protein, TNF-RI Protein, TNFAR Protein, TNFR-I Protein, TNFR1 Protein, TNFR55 Protein, TNFR60 Protein, TNFRI Protein, TNFRSF1a Protein, TNR1A_HUMAN Protein, Tumor necrosis factor receptor 1 Protein, Tumor necrosis factor receptor superfamily, member 1A Protein, Tumor necrosis factor receptor type 1 Protein, Tumor necrosis factor receptor type I Protein, Tumor necrosis factor-binding protein 1 Protein

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P19438

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols