You have no items in your shopping cart.
Human TNFR1 protein
SKU: orb245321
Featured
Description
Research Area
Cell Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Molecular Weight | 47.2 kDa |
| Expression Region | 31-210aa |
| Protein Length | Partial |
| Protein Sequence | VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CD120a Protein, FPF Protein, MGC19588 Protein, p55 Protein, p55-R Protein, p60 Protein, TBP1 Protein, TBPI Protein, TNF R Protein, TNF R55 Protein, TNF-R1 Protein, TNF-RI Protein, TNFAR Protein, TNFR-I Protein, TNFR1 Protein, TNFR55 Protein, TNFR60 Protein, TNFRI Protein, TNFRSF1a Protein, TNR1A_HUMAN Protein, Tumor necrosis factor receptor 1 Protein, Tumor necrosis factor receptor superfamily, member 1A Protein, Tumor necrosis factor receptor type 1 Protein, Tumor necrosis factor receptor type I Protein, Tumor necrosis factor-binding protein 1 Protein
Similar Products
−TRADD Antibody [orb51626]
ELISA, IF, IHC, IP, WB
Human, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgHuman Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA Kit [orb775236]
Human
15.63-1000 pg/mL
6.3 pg/mL
48 T, 96 THuman Soluble Tumor Necrosis Factor Receptor Superfamily, Member 1A (sTNFRSF1A) ELISA Kit [orb1146887]
Human
15.63-1000 pg/mL
6.5 pg/mL
96 T, 48 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human TNFR1 protein (orb245321)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review











