You have no items in your shopping cart.
ACE2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Rat |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ACE2 |
| Target | ACE2 |
| Protein Sequence | Synthetic peptide located within the following region: FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP |
| Molecular Weight | 89kDa |
| Purity | Affinity Purified |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−ACE2 Rabbit Polyclonal Antibody [orb704533]
IF, IHC-Fr, IHC-P, WB
Mouse, Rat
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlACE2 Rabbit Polyclonal Antibody [orb10029]
IF, IHC-Fr, IHC-P, WB
Canine, Mammal, Porcine, Sheep
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μlACE2 Rabbit Polyclonal Antibody [orb638863]
FC, ICC, WB
Bovine, Canine, Equine, Gallus, Mammal, Porcine, Rabbit, Rat
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Lane 1: 50 ug rat liver lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Goat anti rabbit-HRP, Secondary Antibody dilution: 1:2000, Gene Name: ACE2.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

Testis

WB Suggested Anti-ACE2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human kidney.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.
Documents Download
Request a Document
Protocol Information
Gultom, Mitra et al. Susceptibility of Well-Differentiated Airway Epithelial Cell Cultures from Domestic and Wild Animals to Severe Acute Respiratory Syndrome Coronavirus 2 Emerg Infect Dis, 27, 1811-1820 (2021)
ACE2 Rabbit Polyclonal Antibody (orb582208)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review























