You have no items in your shopping cart.
Anti-SARS-CoV-2 NSP9 Antibody
SKU: orb2602843
Description
Images & Validation
−
| Tested Applications | ELISA |
|---|---|
| Reactivity | Human |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Immunogen | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Molecular Weight | 140 kDa, 130 kDa, 110 kDa |
| Purification | Immunogen affinity purified. |
| Conjugation | Biotin |
Storage & Handling
−| Storage | Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
| Disclaimer | For research use only |
Alternative Names
−Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp9; Non-structural protein 9
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Anti-SARS-CoV-2 NSP9 Antibody (orb2602843)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review