You have no items in your shopping cart.
BDNF Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Monkey, Mouse |
| Predicted Reactivity | Canine, Equine, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BDNF |
| Target | BDNF |
| Protein Sequence | Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
| Molecular Weight | 28 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−BDNF Rabbit Polyclonal Antibody [orb155815]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlTrk B rabbit pAb Antibody [orb769307]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μlBDNF Rabbit Polyclonal Antibody [orb251616]
ELISA, IHC-P
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
Unconjugated
100 μgTrk B (phospho Tyr516) rabbit pAb Antibody [orb769304]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlBDNF Rabbit Polyclonal Antibody [orb340144]
ELISA, IHC-P
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.The canonical isoform of 28 kDa is present as well as a second isoform around 37 kDa. Several isoforms of similar size contain this peptide sequence.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human ACHN, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Type: ACHN Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

Sample Type: ACHN Whole Cell lysates, Antibody Dilution: 1 ug/ml.

Sample Type: Fetal Liver lysates, Antibody Dilution: 0.5 ug/ml.

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: BDNF, Gene Name: BDNF.

Sample Type: Ventral horn region of mouse spinal cord, Primary Antibody Dilution: 1:200, Secondary Antibody: Donkey anti-rabbit CY2, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green:BDNF, Gene Name: BDNF.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-BDNF Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Documents Download
Request a Document
Protocol Information
BDNF Rabbit Polyclonal Antibody (orb578294)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





















