Bovine IL-1F5 protein

SKU: orb1215724

Description

The Bovine IL-36 Receptor Antagonist Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-36 Receptor Antagonist Biotinylated applications are for cell culture. Bovine IL-36 Receptor Antagonist Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-36 Receptor Antagonist Biotinylated Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD) (Gene ID: 518514).

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Bovine
Target	IL-1F5
Molecular Weight	17.1 kDa
Protein Length	155.0
Protein Sequence	MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD
Purity	98%

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

IL-1F5

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols