CACNA1G Rabbit Polyclonal Antibody

SKU: orb329837

Description

Rabbit polyclonal antibody to CACNA1G

Research Area

Cell Biology, Pharmacology & Drug Discovery

Images & Validation

−

Item 1 of 4

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human CACNA1G
Target	CACNA1G
Protein Sequence	Synthetic peptide located within the following region: VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS
Molecular Weight	241 kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti Ca(V)T.1 antibody, anti Cav3.1 antibody, anti MGC117234 antibody, anti NBR13 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5 ug/mL using anti-CACNA1G antibody (orb329837).

WB Suggested Anti-CACNA1G Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Spleen.

Quick Database Links

Gene Symbol

CACNA1G

UniProt

O43497

RefSeq (Protein):NP_938202

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_938202

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols