You have no items in your shopping cart.
CACNA1G Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CACNA1G |
| Target | CACNA1G |
| Protein Sequence | Synthetic peptide located within the following region: VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS |
| Molecular Weight | 241 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CACNA1G + CACNA1H Rabbit Polyclonal Antibody [orb156239]
IF, IHC-Fr, IHC-P
Bovine, Canine
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μlCACNA1G Rabbit Polyclonal Antibody [orb5778]
IF, IHC-Fr, IHC-P
Bovine, Canine
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μlCACNA1G Rabbit Polyclonal Antibody (Biotin) [orb2133299]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL.

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5 ug/mL using anti-CACNA1G antibody (orb329837).

WB Suggested Anti-CACNA1G Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Spleen.
Documents Download
Request a Document
Protocol Information
CACNA1G Rabbit Polyclonal Antibody (orb329837)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review












