You have no items in your shopping cart.
Canine VEGF-A protein
SKU: orb1216308
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Canine |
| Target | VEGF-A |
| Molecular Weight | 22.0 kDa |
| Protein Length | 188.0 |
| Protein Sequence | APMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQEKKSIRGKGKGQKRKRKKSRYKPWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (188) |
| Purity | 98% |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
VEGF-A
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Canine VEGF-A protein (orb1216308)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review