Cart summary

You have no items in your shopping cart.

DNAJC7 Rabbit Polyclonal Antibody (Biotin)

SKU: orb2091283

Description

DNAJC7 Rabbit Polyclonal Antibody (Biotin)

Images & Validation

Tested ApplicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human DNAJC7
Protein SequenceSynthetic peptide located within the following region: KTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMH
Molecular Weight56kDa
PurificationAffinity Purified
ConjugationBiotin

Storage & Handling

StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DJ11, DJC7, TPR2, TTC2

Similar Products

  • DNAJC7 Rabbit Polyclonal Antibody (Biotin) [orb445941]

    WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003306

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

DNAJC7 Rabbit Polyclonal Antibody (Biotin) (orb2091283)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet