Cart summary

You have no items in your shopping cart.

ERLIN2 Rabbit Polyclonal Antibody

SKU: orb326257

Description

Rabbit polyclonal antibody to ERLIN2

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityMouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ERLIN2
TargetERLIN2
Protein SequenceSynthetic peptide located within the following region: ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
Molecular Weight38kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti C8orf2 antibody, anti Erlin-2 antibody, anti MGC87072 antibody, anti SPFH2 antibody, anti NET32 antibody, anti SPG18 antibody

Similar Products

  • Erlin-2/ERLIN2 Rabbit Polyclonal Antibody [orb763166]

    ELISA,  FC,  ICC,  IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • ERLIN2 Antibody [orb626805]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • ERLIN2 Rabbit Polyclonal Antibody (HRP) [orb2100032]

    WB

    Human, Mouse, Porcine, Rabbit, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
  • ERLIN2 Rabbit Polyclonal Antibody (FITC) [orb2100033]

    WB

    Human, Mouse, Porcine, Rabbit, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
  • ERLIN2 Rabbit Polyclonal Antibody (Biotin) [orb2100034]

    WB

    Human, Mouse, Porcine, Rabbit, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ERLIN2 Rabbit Polyclonal Antibody

ERLIN2 antibody - middle region (orb326257) validated by WB using HeLa, aT3 cells at 1:200 / 1:1000.

ERLIN2 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

ERLIN2 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

ERLIN2 Rabbit Polyclonal Antibody

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.

ERLIN2 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

ERLIN2 Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

ERLIN2 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

ERLIN2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

ERLIN2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

ERLIN2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

ERLIN2 Rabbit Polyclonal Antibody

WB Suggested Anti-ERLIN2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, ERLIN2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_009106

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ERLIN2 Rabbit Polyclonal Antibody (orb326257)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry