Cart summary

You have no items in your shopping cart.

Exd Rabbit Polyclonal Antibody

SKU: orb325377

Description

Rabbit polyclonal antibody to exd

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityDrosophila
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Fruit fly
Targetexd
Protein SequenceSynthetic peptide located within the following region: EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA
Molecular Weight42kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti Dmel_CG8933 antibody, anti CG8933 antibody, anti DExd antibody, anti Dm-EXD antibody, anti Dpbx antibody, anti EXD antibody, anti td48 antibody, anti unnamed antibody, anti anon-EST:fe1H3 antibody, anti Dmel\CG8933 antibody, anti Exd antibody, anti l(1)IV antibody, anti Pbx1 antibody

Similar Products

  • Exd Rabbit Polyclonal Antibody (HRP) [orb2115083]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • Exd Rabbit Polyclonal Antibody (FITC) [orb2115084]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
  • Exd Rabbit Polyclonal Antibody (Biotin) [orb2115085]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Exd Rabbit Polyclonal Antibody

exd antibody - C-terminal region (orb325377) validated by WB using Drosophila EXD constructs at 1:1000.

Exd Rabbit Polyclonal Antibody

Lanes: Lane 1: E. coli purified Exd (no tag), Lane 2: Cell free expressed Exd (His tag), Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:5000, Gene Name: exd.

Exd Rabbit Polyclonal Antibody

WB Suggested Anti-exd Antibody Titration: 5.0 ug/mL, Positive Control: Drosophila.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_727924

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Exd Rabbit Polyclonal Antibody (orb325377)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 6,890.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry