Cart summary

You have no items in your shopping cart.

FTH1 Rabbit Polyclonal Antibody

SKU: orb330765

Description

Rabbit polyclonal antibody to FTH1

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FTH1
TargetFTH1
Protein SequenceSynthetic peptide located within the following region: NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM
Molecular Weight21 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FTH antibody, anti FTHL6 antibody, anti MGC104426 antibody, anti PIG15 antibody, anti PLIF antibody, anti FHC antibody

Similar Products

  • Ferritin Heavy Chain/FTH1 Rabbit Polyclonal Antibody [orb101461]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Ferritin heavy chain rabbit pAb Antibody [orb768275]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Ferritin Heavy Chain/FTH1 Rabbit Polyclonal Antibody (PE-Cy7) [orb892191]

    FC,  ICC,  IF

    Bovine, Canine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    PE/Cy7

    100 μl
  • Ferritin Heavy Chain/FTH1 Rabbit Polyclonal Antibody (APC) [orb993617]

    FC,  ICC,  IF

    Bovine, Canine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    APC

    100 μl
  • FTH1 Rabbit Polyclonal Antibody [orb1175394]

    ELISA,  IHC,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

FTH1 Rabbit Polyclonal Antibody

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

FTH1 Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. FTH1 is supported by BioGPS gene expression data to be expressed in HeLa.

FTH1 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

FTH1 Rabbit Polyclonal Antibody

Kidney

FTH1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

FTH1 Rabbit Polyclonal Antibody

WB Suggested Anti-FTH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002023

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

FTH1 Rabbit Polyclonal Antibody (orb330765)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry