Cart summary

You have no items in your shopping cart.

G3BP1 Rabbit Polyclonal Antibody

SKU: orb329937

Description

Rabbit polyclonal antibody to G3BP1

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology

Images & Validation

Tested ApplicationsIP, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human G3BP1
TargetG3BP1
Protein SequenceSynthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
Molecular Weight52kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti G3BP antibody, anti HDH-VIII antibody, anti MGC111040 antibody

Similar Products

  • G3BP/G3BP1 Rabbit Polyclonal Antibody [orb1097998]

    FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • G3BP1 (phospho Ser232) rabbit pAb Antibody [orb764192]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • G3BP1 rabbit pAb Antibody [orb765259]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • G3BP Rabbit Polyclonal Antibody [orb329936]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • G3BP1 Rabbit Polyclonal Antibody [orb627171]

    ELISA,  FC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

G3BP1 Rabbit Polyclonal Antibody

Amount and Sample Type: 500 ug rat brain homogenate, Amount of IP Antibody: 6 ug, Primary Antibody: G3BP1, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:5000, Gene Name: G3BP1.

G3BP1 Rabbit Polyclonal Antibody

IP Suggested Anti-G3BP1 Antibody, Positive Control: NT2 CELL/BRAIN TISSUE.

G3BP1 Rabbit Polyclonal Antibody

Lanes: 1. Human NT-2 cells (60 ug) lysate 2. Mouse WT brain extract (80 ug), Primary Antibody Dilution: 2 ug/mL, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000, Gene Name: G3BP1.

G3BP1 Rabbit Polyclonal Antibody

Rabbit Anti-G3BP1 Antibody, Catalog Number: orb329937, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

G3BP1 Rabbit Polyclonal Antibody

WB Suggested Anti-G3BP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate, G3BP1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005745

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IP
Immunoprecipitation
View Protocol

G3BP1 Rabbit Polyclonal Antibody (orb329937)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry