Cart summary

You have no items in your shopping cart.

GPR75 Rabbit Polyclonal Antibody

SKU: orb574512

Description

Rabbit polyclonal antibody to GPR75

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Pharmacology & Drug Discovery

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
Application Notes
Application Info: Pregnenolone (3?-hydroxypregn-5-en-20-one) is the first steroid to be derived from cholesterol in the pathway of steroidogenesis, and it is the common precursor for all of the adrenal and gonadal steroids. Its production occurs in the mitochondrion by cleavage of the C-20 side chain of cholesterol by the P-450SCC enzyme. Once produced, pregnenolone may be utilized by two pathways of steroidogenesis. Pregnenolone may either be converted to 17-OH pregnenolone via the enzymatic action of 17?-hydroxylase or to progesterone via the enzymatic action of 3?-hydroxysteroid dehydrogenase. Elevated pregnenolone levels occur in forms of congenital adrenal hyperplasia (CAH), due to 3?-hydroxysteroid dehydrogenase deficiency or 17?-hydroxylase deficiencies. Higher levels have also been reported in women with idiopathic hirsutism. Studies on pregnenolone levels in regard to sex and age differences indicate that maximum levels occur at approximately 17 and 16 years of age for women and men, while minimum levels occur at approximately 37 and 38 years of age for women and men, respectively. In general, women were found to have slightly higher values when compared to men. Many areas of pregnenolone physiology remain to be investigated. Current research indicates that the determination of pregnenolone in serum may be useful for studying its metabolite, pregnenolone sulfate, which has been reported to have various effects in the mammalian brain and central nervous system.

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human GPR75
TargetGPR75
Protein SequenceSynthetic peptide located within the following region: GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY
Molecular Weight59 kDa
Purity>95%
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ACDC, ADPN, APM1, APM-1, GBP28, ACRP30, ADIPQTL1

Similar Products

  • GPR75 rabbit pAb Antibody [orb767448]

    ELISA,  IF,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • GPR75 Rabbit Polyclonal Antibody [orb574513]

    WB

    Bovine, Equine, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • GPR75 Antibody [orb2651190]

    IF,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl
  • GPR75 Antibody [orb672480]

    ELISA,  IF,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • GPR75 Rabbit Polyclonal Antibody [orb574928]

    WB

    Bovine, Equine, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GPR75 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

GPR75 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

GPR75 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/ml. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.

GPR75 Rabbit Polyclonal Antibody

WB Suggested Anti-GPR75 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006785

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

GPR75 Rabbit Polyclonal Antibody (orb574512)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry