You have no items in your shopping cart.
Hspbp1 Rabbit Polyclonal Antibody (Biotin)
SKU: orb2105941
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat |
Related Conjugates & Formulations
−Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Hspbp1 |
| Protein Sequence | Synthetic peptide located within the following region: VLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFC |
| Molecular Weight | 39kDa |
| Purification | Affinity Purified |
| Conjugation | Biotin |
Storage & Handling
−| Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Hspbp1 Rabbit Polyclonal Antibody (Biotin) [orb2105944]
WB
Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μlHspBP1 Rabbit Polyclonal Antibody (Biotin) [orb451120]
IF, IHC-Fr, IHC-P
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Sheep
Rat
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Hspbp1 Rabbit Polyclonal Antibody (Biotin) (orb2105941)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review