You have no items in your shopping cart.
Human FGF4 protein
SKU: orb594752
Featured
Description
Research Area
Signal Transduction
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using MCF7 Human breast cancer cells is 2-20 ng/ml. |
| Tag | Tag-Free |
| Molecular Weight | 16.9 kDa |
| Expression Region | 54-206aa |
| Protein Length | Partial |
| Protein Sequence | SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3
Similar Products
−- Item 1 of 1
Human Fibroblast Growth Factor 4 (FGF4) ELISA Kit [orb1807534]
Human
15.63-1000pg/mL
5.47 pg/mL
96 T, 48 T - Item 1 of 1
Human Fibroblast Growth Factor 4 (FGF4) ELISA Kit [orb775280]
Human
15.63-1000 pg/mL
6 pg/mL
96 T, 48 T - Item 1 of 3
- Item 1 of 2
- Item 1 of 2
Fibroblast growth factor 4 FGF4 Antibody [orb18030]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human FGF4 protein (orb594752)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks