You have no items in your shopping cart.
Human TGFB2 protein
SKU: orb594750
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 cells is 30-180pg/ml. |
| Tag | Tag-Free |
| Molecular Weight | 12.7 kDa |
| Expression Region | 303-414aa |
| Protein Length | Partial |
| Protein Sequence | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 4 mM HCl |
| Disclaimer | For research use only |
Alternative Names
−Transforming growth factor beta-2;TGFB2;Polyergin;G-TSF;Glioblastoma-derived T-cell suppressor factor;Cetermin;BSC-1 cell growth inhibitor;TGF-beta-2
Similar Products
−- Item 1 of 1
Human Transforming Growth Factor Beta 2 (TGF-β2) ELISA Kit [orb1807182]
Human
31.25-2000pg/mL
13.7 pg/mL
96 T, 48 T - Item 1 of 3
Human TGFB2 protein [orb418749]
Greater than 90% as determined by SDS-PAGE.
16.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 2
- Item 1 of 1
TGF beta 2 (TGFB2) (NM_003238) Human Recombinant Protein [orb3046960]
> 80% as determined by SDS-PAGE and Coomassie blue staining
47.6 kDa
20 μg, 100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human TGFB2 protein (orb594750)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks